missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ IBA1 Polyclonal Antibody
GREENER_CHOICE

Artikelnummer. 16364675 Shop alle Thermo Scientific produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16364675 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16364675 Leverandør Invitrogen™ Leverandørnr. PA595409

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEL whole cell, human THP-1 whole cell. IHC: human spleen tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Ionized calcium-binding adapter molecule 1 (IBA1), also known by its gene name AIF1, is a protein expressed predominantly by microglia in the brain and spinal cord. This protein belongs to the EF-hand calcium-binding protein family and plays a crucial role in microglial activation and migration in response to brain injury or neuroinflammation. IBA1's function is integral to microglial motility and phagocytic activity, facilitating the cellular response to pathogenic stimuli and promoting tissue homeostasis and repair in the central nervous system. IBA1 serves as a reliable marker for activated microglia in various neurological disorders, including Alzheimer's disease, Parkinson's disease, and multiple sclerosis, where increased expression correlates with disease progression and severity. The protein's structural features enable it to bind calcium ions, inducing conformational changes that activate signaling pathways essential for microglial function. Its expression is highly regulated by inflammatory cytokines, underpinning its role in neuroimmune responses. Due to its specific expression in microglia during pathological conditions, IBA1 is widely used in research as a marker to study microglial status and activity, and it remains a focal point for understanding microglial involvement in neurodegenerative diseases.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen IBA1
Applikationer Immunohistochemistry (Paraffin), Western Blot
Klassifikation Polyclonal
Koncentration 500 μg/mL
Konjugeret Unconjugated
Formulering PBS with 4mg trehalose and no preservative
Gene AIF1
Genadgangsnr. P55008
Gene Alias AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific
Gensymboler AIF1
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK).
Oprensningsmetode Affinity chromatography
Mængde 100 μg
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 199
Målarter Human
Indhold og opbevaring -20°C
Produkttype Antibody
Form Lyophilized
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.