missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNRD1 Full-length ORF (NP_055411.1, 1 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00030834-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179342

  • 4040.00 DKK / 25µg
Estimated Shipment: 18-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein with similarity to the Saccharomyces cerevisiae Rpa12p subunit of RNA polymerase I. Alternate splicing of this gene results in two transcript variants encoding the same protein. Additional splice variants have been described, but their full-length sequences have not been determined. [provided by RefSeq]

Sequence: MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Specifications

Specifications

NP_055411.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
40.3kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HTEX-6/MGC13376/Rpa12/TEX6/hZR14/tctex-6
ZNRD1
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
30834
ZNRD1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
RUO
ZNRD1
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers