missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZNF585A Full-length ORF (AAH26081.1, 1 a.a. - 113 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00199704-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Sequence: MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETYSHLLSIGYQVPEAEVVMLEQGKEPWALQGERPRQSCPAPCLVNSHHLQESFRGSpecifications
AAH26081.1 | |
Liquid | |
199704 | |
ZNF585A (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETYSHLLSIGYQVPEAEVVMLEQGKEPWALQGERPRQSCPAPCLVNSHHLQESFRG | |
RUO | |
ZNF585A | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
39.3kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ23765/FLJ31827 | |
ZNF585A | |
Yes | |
wheat germ expression system |