Learn More
Abnova™ Human ZNF239 Partial ORF (NP_005665.1, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008187-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]).[supplied by OMIM]
Sequence: MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEESpecifications
NP_005665.1 | |
Liquid | |
8187 | |
ZNF239 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HOK-2/MOK2 | |
ZNF239 | |
Yes | |
wheat germ expression system |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEE | |
RUO | |
ZNF239 | |
Wheat Germ (in vitro) | |
GST |