missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human XPO6 Partial ORF (NP_055986.1, 903 a.a. - 1010 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023214-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Exportins, such as XPO6, recruit cargo in the nucleoplasm in the presence of RAN (MIM 601179)-GTP and form ternary export complexes. These complexes are transported through nuclear pore complexes to the cytoplasm, where GTP is hydrolyzed and the export complex is disassembled.[supplied by OMIM]
Sequence: PGQVFKPFLPSIIALCMEQVYPIIAERPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQSpecifications
| NP_055986.1 | |
| Liquid | |
| 23214 | |
| XPO6 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EXP6/FLJ22519/KIAA0370/RANBP20 | |
| XPO6 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.62kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PGQVFKPFLPSIIALCMEQVYPIIAERPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQ | |
| RUO | |
| XPO6 | |
| Wheat Germ (in vitro) | |
| GST |