missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human WDR57 Partial ORF (NP_004805.1, 262 a.a. - 357 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009410-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs. [provided by RefSeq]
Sequence: WDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQSpecifications
| NP_004805.1 | |
| Liquid | |
| 9410 | |
| WDR57 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 40K/FLJ41108/HPRP8BP/MGC1910/PRP8BP/PRPF8BP/RP11-490K7.3/SPF38/WDR57 | |
| SNRNP40 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.3kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| WDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ | |
| RUO | |
| SNRNP40 | |
| Wheat Germ (in vitro) | |
| GST |