missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human VCP Partial ORF (AAH07562.2, 221 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007415-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
The protein encoded by this gene is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. This protein, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation. [provided by RefSeq]
Sequence: IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPSpecifications
| AAH07562.2 | |
| Liquid | |
| 7415 | |
| VCP (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| IBMPFD/MGC131997/MGC148092/MGC8560/TERA/p97 | |
| VCP | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.64kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP | |
| RUO | |
| VCP | |
| Wheat Germ (in vitro) | |
| GST |