missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30196839

Invitrogen™ Human V-ATPase G1 (aa 42-115) Control Fragment Recombinant Protein

Artikelnummer. 30196839
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30196839

Brand: Invitrogen™ RP104763

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65342 (PA5-65342. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer O75348
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 9550
Navn Human V-ATPase G1 (aa 42-115) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 1810024D14Rik; AA960677; ATP6G; ATP6G1; ATP6GL; ATP6J; ATP6V1G1; ATPase H+ transporting V1 subunit G1; ATPase, H transporting, lysosomal V1 subunit G1; ATPase, H+ transporting, lysosomal (vacuolar proton pump); ATPase, H+ transporting, lysosomal (vacuolar proton pump), member J; ATPase, H+ transporting, lysosomal 13 kD, V1 subunit G; ATPase, H+ transporting, lysosomal 13 kDa, V1 subunit G1; ATPase, H+ transporting, lysosomal V1 subunit G1; ATPase, H+ transporting, V1 subunit G; DKFZp547P234; lysosomal 13 kDa; vacuolar ATP synthase subunit M16; vacuolar H(+)-ATPase subunit G 1; vacuolar proton pump subunit G 1; Vacuolar proton pump subunit M16; VAG1; V-ATPase 13 kDa subunit 1; V-ATPase subunit G 1; Vma10; V-type proton ATPase subunit G 1
Fælles navn V-ATPase G1
Gen symbol ATP6V1G1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.