missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human UFD1L (aa 58-102) Control Fragment Recombinant Protein

Artikelnummer. 30210705
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30210705

Brand: Invitrogen™ RP105824

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83136 (PA5-83136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin-mediated proteolysis requires the transfer of ubiquitin (Ub) to lysine groups on selected cellular proteins, which then potentiates the proteolytic degradation of these protein conjugates by the 26S proteasome. Ub-fusions are cleaved by Ub-specific processing proteases (UBps) or alternatively by the Ub-fusion degradation (UFD) pathway. The UBP pathway targets the C-terminal glycine residue on Ub that is involved in the formation of Ub-conjugates, while UFD proteins preferentially cleave Ub-conjugated proteins that contain an amino acid substitution at this glycine residue. The UFD1 protein was originally characterized in the yeast S. cerevisiae and subsequently, the human homolog UFD1 or UFD1L was identified. In vitro, UFD1 attenuates the degradation of Ub-fusions, which have a proline or valine residue substituted at the Gly76 moiety, by the selective multiubiquitination of the Ub chain of the Ub-conjugate. Mutations within the UFD1 gene are implicated in the development of CATCH22 syndrome, which is characterized by cardiac defects, cleft palate and hypocalcemia, suggesting that this proteolytic pathway may be involved in the progression of these developmental defects.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q92890
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 7353
Navn Human UFD1L (aa 58-102) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias RGD:619822}; UB fusion protein 1; UB fusion protein 1 {ECO:0000250; ubiquitin fusion degradation 1 like; ubiquitin fusion degradation 1 like (yeast); Ubiquitin fusion degradation protein 1; Ubiquitin fusion degradation protein 1 homolog; ubiquitin fusion degradation protein 1 homolog {ECO:0000250; Ubiquitin recognition factor in ER-associated degradation protein 1; UFD1; UFD1L; ufd1l {ECO:0000312; UniProtKB:Q92890}
Fælles navn UFD1L
Gen symbol UFD1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens RLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNL
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.