Learn More
Abnova™ Human TSSK6 Partial ORF (AAH14611, 174 a.a. - 273 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00083983-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
TSSK6 is a serine/threonine protein kinase that is required for postmeiotic chromatin remodeling and male fertility (Spiridonov et al., 2005 [PubMed 15870294]).[supplied by OMIM]
Sequence: SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSGSpecifications
AAH14611 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG | |
RUO | |
TSSK6 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
83983 | |
TSSK6 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ24002/SSTK/TSSK4 | |
TSSK6 | |
Recombinant | |
wheat germ expression system |