missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human TNFRSF14 (aa 3-100) Control Fragment Recombinant Protein

Artikelnummer. 30199251
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30199251

Brand: Invitrogen™ RP88848

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNFRSF14 is a member of the TNF-receptor superfamily. TNFRSF14 was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to TNFRSF14 has been shown to be part of the viral entry mechanism. The cytoplasmic region of TNFRSF14 was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. Activation of the signal transduction pathway involving TNFRSF14 in T cells stimulates T cell proliferation and cytokine production, leading to inflammation and enhanced CTL-mediated tumor immunity, suggesting that these proteins may be useful as potential targets for controlling cellular immune responses. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these TNFRSF14 variants have not been determined.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q92956
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 8764
Navn Human TNFRSF14 (aa 3-100) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias Atar; CD270; CD40-like protein; herpes virus entry mediator; herpes virus entry mediator A; Herpesvirus entry mediator A; HGNC:11912; HVEA; Hvem; LIGHTR; RP3-395M20.6; sCD2710; TNF receptor superfamily member 14; Tnfrs14; TNFRSF14; TR2; tumo; Tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); Tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; UNQ329/PRO509
Fælles navn TNFRSF14 (HVEM)
Gen symbol TNFRSF14
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.