missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human THAP11 Partial ORF (NP_065190.2, 1 a.a. - 85 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00057215-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene contains a THAP domain, which is a conserved DNA-binding domain that has striking similarity to the site-specific DNA-binding domain (DBD) of Drosophila P element transposases. [provided by RefSeq]
Sequence: MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVSpecifications
| NP_065190.2 | |
| Liquid | |
| 57215 | |
| THAP11 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CTG-B43a/CTG-B45d/HRIHFB2206/RONIN | |
| THAP11 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.09kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGV | |
| RUO | |
| THAP11 | |
| Wheat Germ (in vitro) | |
| GST |