missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TFAP2A Partial ORF (AAH17754, 99 a.a. - 205 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007020-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM]
Sequence: SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFSpecifications
| AAH17754 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.40kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF | |
| RUO | |
| TFAP2A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 7020 | |
| TFAP2A (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AP-2/AP-2alpha/AP2TF/BOFS/TFAP2 | |
| TFAP2A | |
| Recombinant | |
| wheat germ expression system |