missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ST6GAL2 Partial ORF (NP_115917.1, 33 a.a. - 141 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084620-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16180797

  • 2665.00 DKK / 10µg
Estimated Shipment: 29-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sialyltransferases, such as ST6GAL2 (EC 2.4.99.1), are type II transmembrane proteins that catalyze the transfer of sialic acid from CMP-sialic acid to an acceptor carbohydrate, usually to the terminal ends of carbohydrate chains.[supplied by OMIM]

Sequence: SNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWH
Specifications

Specifications

NP_115917.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWH
RUO
ST6GAL2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
84620
ST6GAL2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ30711/FLJ37730/FLJ38334/KIAA1877/SIAT2/ST6GalII
ST6GAL2
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers