missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. Abnova™ Human SPOP Partial ORF (NP_001007227.1, 301 a.a. - 374 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SPOP Partial ORF (NP_001007227.1, 301 a.a. - 374 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16198485
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16198485 25 μg
16188485 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16198485 Leverandør Abnova™ Leverandørnr. H00008405Q01.25ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Used for AP, Array, ELISA, WB-Re

This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Sequence: NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

Tekniske data

Adgangsnummer NP_001007227.1
Til brug med (applikation) Antibody Production, ELISA, Protein Array, Western Blot
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-id (Entrez) 8405
Molekylvægt (g/mol) 33.88kDa
Navn SPOP (Human) Recombinant Protein (Q01)
Kvalitetskontrol test 12.5% SDS-PAGE Stained with Coomassie Blue.
Mængde 25 μg
Immunogen NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatorisk status RUO
Gene Alias TEF2
Fælles navn SPOP
Gen symbol SPOP
Arter Wheat Germ (in vitro)
Rekombinant Recombinant
Protein tag GST
Udtrykssystem wheat germ expression system
Form Liquid
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.