missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SLC24A3 (aa 260-325) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP99470
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61020 (PA5-61020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Plasma membrane sodium/calcium exchangers are an important component of intracellular calcium homeostasis and electrical conduction. Potassium-dependent sodium/calcium exchangers such as SLC24A3 are believed to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions (Kraev et al., 2001 [PubMed 11294880]).[supplied by OMIM, Mar 2008].
Specifications
| Q9HC58 | |
| Blocking Assay, Control | |
| 57419 | |
| 100 ÎĽL | |
| Na(+)/K(+)/Ca(2+)-exchange protein 3; NCK x 3; Slc24a3; sodium calcium exchanger; sodium/potassium/calcium exchanger 3; solute carrier family 24 (sodium/potassium/calcium exchanger), member 3; solute carrier family 24 member 3 | |
| SLC24A3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SLC24A3 (aa 260-325) Control Fragment | |
| RUO | |
| SLC24A3 | |
| Unconjugated | |
| Recombinant | |
| CIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSF | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human SLC24A3 (aa 260-325) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction