missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30200181

Invitrogen™ Human SIPA1L1 (aa 170-319) Control Fragment Recombinant Protein

Code produit. 30200181
Click to view available options
Mængde:
100 μL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30200181

Marque: Invitrogen™ RP89050

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51761 (PA5-51761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal-induced proliferation associated-like protein 1 (SIPA1L1) is a member of the SIPA1 family of RapGAPs. SIPA1L1 was initially identified as a binding partner and degradation target of the E6 oncoprotein of high-risk papillomaviruses. Recently, it was discovered that Casein kinase I epsilon (CKIe), a Wnt-regulated kinase that regulates Wnt/b-catenin signaling, also can bind to the carboxy-terminus of SIPA1L1. CKIe phosphorylates SIPA1L1, thereby reducing its stability and alleviating its inhibition of Rap1, a protein required for Wnt8/CKIe-mediated gastrulation during embryogenesis, suggesting SIPA1L1 plays important roles in embryo development as well as control of cell proliferation.
TRUSTED_SUSTAINABILITY

Spécification

Adgangsnummer O43166
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 26037
Navn Human SIPA1L1 (aa 170-319) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 4931426N11Rik; AW213287; E6-targeted protein 1; E6TP1; H_DJ1140G11.1; High-risk human papilloma viruses E6 oncoproteins targeted protein 1; Kiaa0440; mKIAA0440; signal induced proliferation associated 1 like 1; signal-induced proliferation-associated 1 like 1; signal-induced proliferation-associated 1-like protein 1; SIPA1L1; SIPA1-like protein 1; Spa1; Spa-1; SPA-1 like protein p1294; SPA-1-like protein p1294; SPAL; Spar; Spine-associated Rap GTPase-activating protein; spine-associated Rap guanosine triphosphatase (GTPase) activating protein (GAP); WUGSC:H_DJ1140G11.1
Fælles navn SIPA1L1
Gen symbol SIPA1L1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens IRQRSNSDITISELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTPTKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLRNAKGEELGKSSDLEDNRSE
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis