missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SETDB2 Partial ORF (NP_114121.1, 451 a.a. - 550 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00083852-Q02.10ug
Additional Details : Weight : 0.02000kg
Description
Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 (see MIM 601128) methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity (Zhang et al., 2003 [PubMed 12754510]).[supplied by OMIM]
Sequence: HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFEDSpecifications
| NP_114121.1 | |
| Liquid | |
| 83852 | |
| SETDB2 (Human) Recombinant Protein (Q02) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C13orf4/CLLD8/CLLL8/DKFZp586I0123/DKFZp761J1217/KMT1F | |
| SETDB2 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED | |
| RUO | |
| SETDB2 | |
| Wheat Germ (in vitro) | |
| GST |