missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SCUBE3 Partial ORF (AAH52263.2, 29 a.a. - 147 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00222663-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075815

  • 2665.00 DKK / 10µg
Estimated Shipment: 15-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDN
Specifications

Specifications

AAH52263.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.83kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDN
RUO
SCUBE3
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
222663
SCUBE3 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CEGF3/DKFZp686B09105/DKFZp686B1223/DKFZp686D20108/FLJ34743
SCUBE3
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers