missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SCRG1 Full-length ORF (NP_009212.1, 1 a.a. - 98 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00011341-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Scrapie-responsive gene 1 is associated with neurodegenerative changes observed in transmissible spongiform encephalopathies. It may play a role in host response to prion-associated infections. The scrapie responsive protein 1 may be partly included in the membrane or secreted by the cells due to its hydrophobic N-terminus. [provided by RefSeq]
Sequence: MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQSpecifications
| NP_009212.1 | |
| Liquid | |
| 11341 | |
| SCRG1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ | |
| RUO | |
| SCRG1 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.5kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC26468/SCRG-1 | |
| SCRG1 | |
| Yes | |
| wheat germ expression system |