missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SAMD9L (aa 1245-1355) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP92806
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53991 (PA5-53991. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The function of this protein has not been specifically defined.
Specifications
| Q8IVG5 | |
| Blocking Assay, Control | |
| 219285 | |
| 100 ÎĽL | |
| AA175286; C7orf6; DRIF2; ESTM25; KIAA2005; mKIAA2005; SAM domain-containing protein 9-like; SAMD9L; sterile alpha motif domain containing 9 like; sterile alpha motif domain containing 9-like; sterile alpha motif domain-containing protein 9-like; UEF; UEF1; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived | |
| SAMD9L | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SAMD9L (aa 1245-1355) Control Fragment | |
| RUO | |
| SAMD9L | |
| Unconjugated | |
| Recombinant | |
| ECYLALSKFTSHLKNLQSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKESQLLQEENCRKKLEALRADRFAGLLEYLNPNYKDAT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human SAMD9L (aa 1245-1355) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction