missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30200510

Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein

Artikelnummer. 30200510
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30200510 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30200510 Leverandør Invitrogen™ Leverandørnr. RP91392

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q9Y3I0
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 51493
Navn Human RTCB (aa 340-499) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871
Fælles navn RTCB
Gen symbol Rtcb
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.