Learn More
Abnova™ Human RNF17 Partial ORF (NP_112567, 30 a.a. - 139 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00056163-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene is similar to a mouse gene that encodes a testis-specific protein containing a RING finger domain. [provided by RefSeq]
Sequence: IQCTRCGRRVSRSSGHHCELQCGHAFCELCLLMTEECTTIICPDCEVATAVNTRQRYYPMAGYIKEDSIMEKLQPKTIKNCSQDFKKTADQLTTGLERSASTDKTLLNSSSpecifications
NP_112567 | |
Liquid | |
56163 | |
RNF17 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ11045/Mmip-2/SPATA23/TDRD4 | |
RNF17 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.84kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
IQCTRCGRRVSRSSGHHCELQCGHAFCELCLLMTEECTTIICPDCEVATAVNTRQRYYPMAGYIKEDSIMEKLQPKTIKNCSQDFKKTADQLTTGLERSASTDKTLLNSS | |
RUO | |
RNF17 | |
Wheat Germ (in vitro) | |
GST |