missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAD9A Partial ORF (AAH14848, 61 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005883-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134025

  • 4040.00 DKK / 25µg
Estimated Shipment: 17-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein is found to possess 3' to 5' exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. It forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. Use of alternative polyA sites has been noted for this gene. [provided by RefSeq]

Sequence: YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCASLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGI
Specifications

Specifications

AAH14848
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCASLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGI
RUO
RAD9A
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
5883
RAD9A (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RAD9
RAD9A
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers