Learn More
Invitrogen™ Human QSOX2 (aa 504-633) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP90405
Description
Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110775 (PA5-110775. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family (QSOX1) that regulates the sensitization of neuroblastoma cells for IFN-gamma (IFNG)-induced cell death.
Specifications
Q6ZRP7 | |
Blocking Assay, Control | |
169714 | |
100 ÎĽL | |
BC030934; neuroblastoma-derived sulfhydryl oxidase; QSCN6L1; QSOX2; quiescin Q6 sulfhydryl oxidase 2; quiescin Q6-like 1; quiescin Q6-like protein 1; quiescin sulfhydryl oxidase 2; SOXN; Sulfhydryl oxidase 2; thiol oxidase 2 | |
Qsox2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human QSOX2 (aa 504-633) Control Fragment | |
RUO | |
QSOX2 | |
Unconjugated | |
Recombinant | |
LWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSADQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQSVRPPGALGPRPALPESLHHSLDGKL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.