missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30181532

Invitrogen™ Human QSOX1 (aa 101-192) Control Fragment Recombinant Protein

Artikelnummer. 30181532
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30181532

Brand: Invitrogen™ RP99851

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59881 (PA5-59881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The QSOX1 gene, also known as Quiescin Q6, is a fusion of two ancient genes: thioredoxin and ERV1. Its expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. The QSOX1 protein oxidizes sulfhydryl groups to form disulfide bonds in proteins. QSOX1 expression is induced by hypoxia and appears to protect cells against oxidative stress-induced apoptosis.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer O00391
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 5768
Navn Human QSOX1 (aa 101-192) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 1300003H02Rik; FAD-dependent sulfhydryl oxidase-2; hQSOX; mSOx; Q6; Qscn6; Qsox; QSO x 1; Quiescin Q6; quiescin Q6 sulfhydryl oxidase 1; quiescin sulfhydryl oxidase 1; RP11-502H18.3; rQSOX; rSOx; Skin sulfhydryl oxidase; Sox; So x 2; Sox-2; Sulfhydryl oxidase 1; testis tissue sperm-binding protein Li 62 n; thiol oxidase 1; UNQ2520/PRO6013
Fælles navn QSOX1
Gen symbol Qsox1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIF
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.