missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human PMCA1 ATPase (aa 2-91) Control Fragment Recombinant Protein

Artikelnummer. 30197908
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30197908

Brand: Invitrogen™ RP89885

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The calcium pump of the plasma membrane, termed PMCA ATPase, pumps calcium from the cytosol to the extracellular space. This membrane-bound enzyme is related to a number of other ATPases including the SERCA ATPase and the sodium/potassium pump. There are four different genes encoding PMCA ATPase and studies have revealed 20 isoforms of the pump generated by alternate splicing of the primary gene products. mRNA distribution studies show that gene products 1 and 4 are transcribed in most tissues, however, products 2 and 3 are more tissue specific. Transcription of the splicing variants has also been found to be tissue specific. In the pancreas, where insulin secretion is calcium dependent, the beta cells only express the 4b isoform, however the alpha and gamma cells express both 4a and 4b isoforms. Studies have also shown that different splice variants have different affinities for calcium and calmodulin.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P20020
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 490
Navn Human PMCA1 ATPase (aa 2-91) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 2810442I22Rik; Atp2b1; ATPase plasma membrane Ca2+ transporting 1; ATPase, Ca++ transporting, plasma membrane 1; E130111D10Rik; plasma membrane Ca2+ pump (PMCA1b); plasma membrane calcium ATPase; Plasma membrane calcium ATPase isoform 1; plasma membrane calcium pump; Plasma membrane calcium pump isoform 1; Plasma membrane calcium-transporting ATPase 1; PMCA1; Pmca1a; Pmca1b; Pmca1c; PMCA1kb
Fælles navn PMCA1 ATPase
Gen symbol ATP2B1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIP
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.