missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human PLEKHM3 (aa 71-158) Control Fragment Recombinant Protein

Artikelnummer. 30198192
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30198192

Brand: Invitrogen™ RP96208

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57127 (PA5-57127. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHM3, also known as DAPR, is a member of the M family of Pleckstrin homology domain-containing proteins. PLEKHM3 was initially identified through chromatin immunoprecipitation and CpG microarray analysis examining proteins regulated by myocyte-enhancing factor 2. In C2C12 myoblast cells, PLEKHM3 binds to the PI3K signaling member protein kinase B in the cytosol prior to differentiation into myotubes. Following the initiation of differentiation, PLEKHM3 was also found in membrane fractions. Knockdown of PLEKHM3 expression by RNAi resulted in the inhibition of myotube formation, suggesting that PLEKHM3 is a key component required by myoblasts for orchestrating their differentiation during myogenesis.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q6ZWE6
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 389072
Navn Human PLEKHM3 (aa 71-158) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 9430067K14Rik; A230102O09Rik; AI449570; Dapr; differentiation associated protein; Differentiation-associated protein; PH domain-containing family M member 3; pleckstrin homology domain containing M3; pleckstrin homology domain containing, family M, member 1-like; pleckstrin homology domain containing, family M, member 3; pleckstrin homology domain-containing family M member 3; PLEKHM1L; Plekhm3; RGD1307151
Fælles navn PLEKHM3
Gen symbol PLEKHM3
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens MIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDNLSWMEQKEASTFNFFNICQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQVD
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.