missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PLD1 Partial ORF (NP_002653, 965 a.a. - 1074 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

2735.00 DKK - 4145.00 DKK

Specifications

Accession Number	NP_002653
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	5337
Molecular Weight (g/mol)	37.84kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16109181 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00005337-Q01.10ug	10 ug	2735.00 DKK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16119181 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00005337-Q01.25ug	25 ug	4145.00 DKK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Phosphatidylcholine (PC)-specific phospholipases D (PLDs; EC 3.1.4.4) catalyze the hydrolysis of PC to produce phosphatidic acid and choline. A range of agonists acting through G protein-coupled receptors and receptor tyrosine kinases stimulate this hydrolysis. PC-specific PLD activity has been implicated in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis (Hammond et al., 1995 [PubMed 8530346]).[supplied by OMIM]

Sequence: GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT

Specifications

Accession Number	NP_002653
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	37.84kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	PLD1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	5337
Name	PLD1 (Human) Recombinant Protein (Q01)
Immunogen	GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Regulatory Status	RUO
Gene Symbol	PLD1
Recombinant	Recombinant
Expression System	wheat germ expression system

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human PLD1 Partial ORF (NP_002653, 965 a.a. - 1074 a.a.) Recombinant Protein with GST-tag at N-terminal

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ Human PLD1 Partial ORF (NP_002653, 965 a.a. - 1074 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents