missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30181167

Invitrogen™ Human PLA2 (aa 15-53) Control Fragment Recombinant Protein

Artikelnummer. 30181167
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30181167

Brand: Invitrogen™ RP99897

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84468 (PA5-84468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phospholipase A2 catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P04054
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 5319
Navn Human PLA2 (aa 15-53) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias Group IB phospholipase A2; group IB secretory phospholipase A(2); MGC119834; MGC119835; phosphatidylcholine 2-acylhydrolase 1 B; phospholipase; phospholipase A2; phospholipase A2 group IB; phospholipase A2, group 1 B; phospholipase A2, group IB (pancreas); phospholipase A2, group IB, pancreas; phospholipase A2, major isoenzyme; PLA2; PLA2A; Pla2g1b; PLA2-Ib; PPLA2; sPLA(2)-IB; sPLA2IB; unnamed protein product
Fælles navn PLA2
Gen symbol PLA2G1B
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens ADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGL
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.