missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human PER2 (aa 751-843) Control Fragment Recombinant Protein

Artikelnummer. 30207942
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30207942

Brand: Invitrogen™ RP104152

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111504 (PA5-111504. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PER2, also known as Period circadian protein homolog 2, is a mainly nuclear protein that shows nucleocytoplasmic shuttling which is effected by interaction with other circadian core oscillator proteins and/or by phosphorylation. PER2 belongs to the basic helix-loop-helix family of transcription factors and contains a PAC (PAS-associated C-terminal) domain and two PAS (PER-ARNT-SIM) domains. PER2 is a component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, BMAL1 or BMAL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. This protein is thus essential for generating circadian rhythms and is a negative element in the circadian transcriptional loop which influences clock function by interacting with other circadian regulatory proteins and transporting them to the nucleus. Expression of PER2 is fairly wide spread with strong expression in skeletal muscle and pancreas and slight expression in lung. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS).
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer O15055
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 8864
Navn Human PER2 (aa 751-843) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias circadian clock protein PERIOD 2; FASPS; FASPS1; hPER2; KIAA0347; mKIAA0347; mPer2; PER2; per2 {ECO:0000312; period 2; period circadian clock 2; period circadian protein 2; period circadian protein homolog 2; period circadian regulator 2; period homolog 2; RGD:61945}; rPER2
Fælles navn PER2
Gen symbol Per2
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens LSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSSCPA
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.