missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PDK4 Partial ORF (AAH40239, 181 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00005166-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. [provided by RefSeq]
Sequence: SDSQTGNPSHIGSIDPNCDVVAVVQDAFGCSRMLCDQYYLSSPELKLTQANGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVSpecifications
| AAH40239 | |
| Liquid | |
| 5166 | |
| PDK4 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ40832 | |
| PDK4 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SDSQTGNPSHIGSIDPNCDVVAVVQDAFGCSRMLCDQYYLSSPELKLTQANGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV | |
| RUO | |
| PDK4 | |
| Wheat Germ (in vitro) | |
| GST |