missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PAX7 Partial ORF (NP_001128726.1, 351 a.a. - 434 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

2665.00 DKK - 4040.00 DKK

Specifications

Accession Number NP_001128726.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 5081
Molecular Weight (g/mol) 34.87kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16084495
View Documents Promotion Details
Abnova™
H00005081-Q02.10UG
10 ug
2665.00 DKK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 15-08-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16094495
View Documents Promotion Details
Abnova™
H00005081-Q02.25UG
25 ug
4040.00 DKK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 15-08-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGD
Specifications

Specifications

NP_001128726.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.87kDa
12.5% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HUP1/PAX7B
PAX7
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
5081
PAX7 (Human) Recombinant Protein (Q02)
AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGD
RUO
PAX7
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications