missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human PARM1 (aa 36-129) Control Fragment Recombinant Protein

Artikelnummer. 30195196
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30195196

Brand: Invitrogen™ RP96730

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58307 (PA5-58307. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PARM1 may regulate TLP1 expression and telomerase activity, thus enabling certain prostatic cells to resist apoptosis.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q6UWI2
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 25849
Navn Human PARM1 (aa 36-129) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias castration-induced prostatic apoptosis-related protein 1; Cipar1; DKFZP564O0823; PARM1; PARM-1; Prostate androgen-regulated mucin-like protein 1; prostatic androgen-regulated mucin-like protein 1; prostatic androgen-repressed message 1; prostatic androgen-repressed message-1; UNQ1879/PRO4322; WSC4; WSC4, cell wall integrity and stress response component 4 homolog
Fælles navn PARM1
Gen symbol PARM1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.