missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human OSGEPL1 (aa 55-185) Control Fragment Recombinant Protein

Artikelnummer. 30195362
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30195362

Brand: Invitrogen™ RP89224

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56541 (PA5-56541. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OSGEPL1, also known as Qri7, is a 414 amino acid protein that belongs to the KAE1/YgjD family and exists as 3 alternatively spliced isoforms. In tRNAs that have codons beginning with adenine, OSGEPL1 is required for the formation of a threonylcarbamoyl group on adenosine. The gene that encodes OSGEPL1 contains about 16,568 bases and maps to human chromosome 2q32.2. Consisting of 237 million bases, chromosome 2 encodes over 1,400 genes and makes up approximately 8% of the human genome. A number of genetic diseases are linked to genes on chromosome 2. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene. The lipid metabolic disorder sitosterolemia is associated with ABCG5 and ABCG8. An extremely rare recessive genetic disorder, Alstrom syndrome, is due to mutations in the ALMS1 gene.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q9H4B0
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 64172
Navn Human OSGEPL1 (aa 55-185) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 2610001M19Rik; AA416452; GCP1; HAMAP-Rule:MF_03179}; N6-L-threonylcarbamoyladenine synthase; OSGEPL1; O-sialoglycoprotein endopeptidase like 1; O-sialoglycoprotein endopeptidase-like 1; O-sialoglycoprotein endopeptidase-like protein 1; O-sialoglycoprotein endopeptidase-like protein 1 {ECO:0000255; probable O-sialoglycoprotein endopeptidase 2; probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial; probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial {ECO:0000255; probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; putative sialoglycoprotease type 2; Qri7; t(6)A synthase; t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1; t(6)A37 threonylcarbamoyladenosine biosynthesis protein Osgepl1 {ECO:0000255; tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; tRNA threonylcarbamoyladenosine biosynthesis protein Osgepl1 {ECO:0000255
Fælles navn OSGEPL1
Gen symbol OSGEPL1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens DETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSD
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.