missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human NSE2 (aa 163-241) Control Fragment Recombinant Protein

Artikelnummer. 30208771
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30208771 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30208771 Leverandør Invitrogen™ Leverandørnr. RP104928

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65676 (PA5-65676. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the large subunit of DNA damage-binding protein which is a heterodimer composed of a large and a small subunit. This protein functions in nucleotide-excision repair. Its defective activity causes the repair defect in the patients with xeroderma pigmentosum complementation group E (XPE). However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q96MF7
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 286053
Navn Human NSE2 (aa 163-241) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 1110014D18Rik; AI661537; C8orf36; E3 SUMO-protein ligase NSE2; E3 SUMO-protein transferase NSE2; FLJ32440; hMMS21; methyl methanesulfonate sensitivity gene 21; MMS21; MMS21 homolog; non-SMC element 2 homolog; non-SMC element 2 homolog (MMS21, S. cerevisiae); non-SMC element 2, MMS21 homolog; non-SMC element 2, MMS21 homolog (S. cerevisiae); non-structural maintenance of chromosomes element 2 homolog; NSE2; NSE2 (MMS21) homolog, SMC5-SMC6 complex SUMO ligase; NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase; NSMCE2; RGD1305156; Unknown (protein for MGC:133996); zinc finger, MIZ-type containing 7; ZMIZ7
Fælles navn NSE2
Gen symbol Nsmce2
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.