missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NR3C1 Partial ORF (AAH15610, 51 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002908-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. Alternate splicing, the use of at least three different promoters, and alternate translation initiation sites result in several transcript variants encoding the same protein or different isoforms, but the full-length nature of some variants has not been determined. [provided by RefSeq]
Sequence: ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSpecifications
| AAH15610 | |
| Liquid | |
| 2908 | |
| NR3C1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GCCR/GCR/GR/GRL | |
| NR3C1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.53kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK | |
| RUO | |
| NR3C1 | |
| Wheat Germ (in vitro) | |
| GST |