missing translation for 'onlineSavingsMsg'
Få mere at vide
Abnova™ Human NID2 Partial ORF (NP_031387.2, 1276 a.a. - 1375 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16104136
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. Abnova™ Human NID2 Partial ORF (NP_031387.2, 1276 a.a. - 1375 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human NID2 Partial ORF (NP_031387.2, 1276 a.a. - 1375 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16104136
25 μg, 25µg
Klik for at se tilgængelige muligheder
Mængde:
10 μg
25 μg
Pakningsstørrelse:
25µg
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 16104136

Brand: Abnova™ H00022795Q01.25ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!


 Se alternative produkter

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Used for AP, Array, ELISA, WB-Re

Basement membranes, which are composed of type IV collagens (see MIM 120130), laminins (see LAMC1; MIM 150290), perlecan (HSPG2; MIM 142461), and nidogen (see NID1; MIM 131390), are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.[supplied by OMIM]

Sequence: PNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK

Tekniske data

Adgangsnummer NP_031387.2
Til brug med (applikation) Antibody Production, ELISA, Protein Array, Western Blot
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-id (Entrez) 22795
Molekylvægt (g/mol) 36.74kDa
Navn NID2 (Human) Recombinant Protein (Q01)
Kvalitetskontrol test 12.5% SDS-PAGE Stained with Coomassie Blue.
Mængde 25 μg
Immunogen PNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatorisk status RUO
Fælles navn NID2
Gen symbol NID2
Arter Wheat Germ (in vitro)
Rekombinant Recombinant
Protein tag GST
Udtrykssystem wheat germ expression system
Form Liquid
Vis mere Vis mindre

Produktforslag

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel
Abnova™ Human NID2 Partial ORF (NP_031387.2, 1276 a.a. - 1375 a.a.) Recombinant Protein with GST-tag at N-terminal >

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.