missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30200760

Invitrogen™ Human Nectin 1 (aa 37-165) Control Fragment Recombinant Protein

Artikelnummer. 30200760
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30200760

Brand: Invitrogen™ RP90093

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82938 (PA5-82938. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain, and a cytoplasmic region. This protein acts as a receptor for glycoprotein D of herpes simplex viruses 1 and 2, and pseudorabies virus and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome as well as non-syndromic cleft lip with or without cleft palate. Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q15223
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 5818
Navn Human Nectin 1 (aa 37-165) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias AI835281; AW549174; CD111; CLPED1; ectodermal dysplasia 4 (Margarita Island type); ED4; herpes simplex virus type 1 sensitivity; herpes virus entry mediator C; Herpesvirus entry mediator C; herpesvirus Ig-like receptor; HIgR; HV1S; Hvec; nectin 1; nectin cell adhesion molecule 1; nectin); Nectin1; nectin-1; nectin-1 alpha; nectin-1 delta; OFC7; poliovirus receptor-like 1; poliovirus receptor-related 1; poliovirus receptor-related 1 (herpesvirus entry mediator C; poliovirus receptor-related 1 (herpesvirus entry mediator C); poliovirus receptor-related 1 (herpesvirus entry mediator C; nectin); poliovirus receptor-related protein 1; PRR; PRR1; PVRL1; PVRR; PVRR1; SK-12
Fælles navn Nectin 1
Gen symbol Nectin1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.