missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human NCKAP5 (aa 501-581) Control Fragment Recombinant Protein

Artikelnummer. 30193555
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30193555

Brand: Invitrogen™ RP96205

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56999 (PA5-56999. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NCKAP5 (NCK Associated Protein 5) is a Protein Coding gene. An important paralog of this gene isNCKAP5L.
TRUSTED_SUSTAINABILITY

Specifications

Adgangsnummer O14513
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 344148
Navn Human NCKAP5 (aa 501-581) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 8430408F21; D130011D22Rik; E030049G20Rik; ERIH; ERIH1; Erih2; Gm1548; NAP5; NAP-5; NCK associated protein 5; NCKAP5; NCK-associated protein 5; Peripheral clock protein; peripheral clock protein 2; RGD1564507
Fælles navn NCKAP5
Gen symbol NCKAP5
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.