missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30212701

Invitrogen™ Human MICB (aa 331-381) Control Fragment Recombinant Protein

Artikelnummer. 30212701
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30212701

Brand: Invitrogen™ RP107349

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66698 (PA5-66698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICB encodes the highly polymorphic MHC (HLA) class I chain-related gene B. The protein product is expressed on the cell surface. It is thought that MICB functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. MICB is broadly recognized by NK cells and T cells with NKG2D receptor on their surface. The complex NKG2D-MICB results in MICB expressing cytolytic T cells and NK cells against epithelial tumor cells.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q29980
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 4277
Navn Human MICB (aa 331-381) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias MHC class I chain-related protein B; MHC class I mic-B antigen; MHC class I polypeptide-related sequence B; MHC class I-like located near the LRC, 2; MHC class I-like molecule PERB11.2-IMX; MHC I like leukocyte 2; MICB; MIC-B; Mill2; Mill2 gene for MHC class I-like located near the LRC, 2, exon 3, partial cds, strain:LEW0.1 Lm1; PERB11.2; sMICB; soluble MICB; stress inducible class I homolog
Fælles navn MICB
Gen symbol MICB
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.