missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MGAT4A Partial ORF (NP_036346, 436 a.a. - 535 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00011320-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of R-Man-alpha-1,6(GlcNAc-beta-1,2-Man-alpha-1,3)Man-beta-1,4-GlcNAc-beta-1,4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation. [provided by RefSeq]
Sequence: PVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATNSpecifications
| NP_036346 | |
| Liquid | |
| 11320 | |
| MGAT4A (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GNT-IV/GNT-IVA | |
| MGAT4A | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN | |
| RUO | |
| MGAT4A | |
| Wheat Germ (in vitro) | |
| GST |
Safety and Handling
Product Identifier
Signal Word
Hazard Category
Hazard Statement
Precautionary Statement
Supplemental information
- MGAT4A (Human) Recombinant Protein (Q01)
Signal Word
- Warning
Hazard Category
- Acute toxicity Category 4
- Serious eye damage/eye irritation Category 2
- Skin corrosion/irritation Category 2
Hazard Statement
- H302-Harmful if swallowed.
- H315-Causes skin irritation.
- H319-Causes serious eye irritation.
Precautionary Statement
- P102-Keep out of reach of children.
- P103-Read label before use.
- P233-Keep container tightly closed.
- P264-Wash hands thoroughly after handling.
- P270-Do not eat, drink or smoke when using this product.
- P280-Wear protective gloves/protective clothing/eye protection/face protection.
- P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
- P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
- P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
- P404-Store in a closed container.
- P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
Supplemental information
- MIXTURE LIST-Contains : tris-HCl, reduced glutathione