missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MESP1 Partial ORF (NP_061140.1, 1 a.a. - 63 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00055897-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
Sequence: MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDSpecifications
| NP_061140.1 | |
| Liquid | |
| 55897 | |
| MESP1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC10676/bHLHc5 | |
| MESP1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.56kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD | |
| RUO | |
| MESP1 | |
| Wheat Germ (in vitro) | |
| GST |