missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MAP3K11 Partial ORF (NP_002410, 741 a.a. - 847 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004296-Q02.10ug
Additional Details : Weight : 0.02000kg
Description
The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42. [provided by RefSeq]
Sequence: PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGPSpecifications
| NP_002410 | |
| Liquid | |
| 4296 | |
| MAP3K11 (Human) Recombinant Protein (Q02) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC17114/MLK-3/MLK3/PTK1/SPRK | |
| MAP3K11 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.51kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP | |
| RUO | |
| MAP3K11 | |
| Wheat Germ (in vitro) | |
| GST |