missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LXN Partial ORF (NP_064554.2, 151 a.a. - 222 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056925-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16178876

  • 4040.00 DKK / 25µg
Estimated Shipment: 22-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq]

Sequence: NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Specifications

Specifications

NP_064554.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
RUO
LXN
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
56925
LXN (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ECI/TCI
LXN
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers