missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LXN Partial ORF (NP_064554.2, 151 a.a. - 222 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00056925-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq]
Sequence: NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLESpecifications
| NP_064554.2 | |
| Liquid | |
| 56925 | |
| LXN (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ECI/TCI | |
| LXN | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.66kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE | |
| RUO | |
| LXN | |
| Wheat Germ (in vitro) | |
| GST |