missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LRP12 Full-length ORF (-, 1 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00029967-P01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene was identified by its differential expression in cancer cells. The product of this gene is predicted to be a transmembrane protein. The level of this protein was found to be lower in tumor derived cell lines compared to normal cells. This gene was thus proposed to be a candidate tumor suppressor gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKENSpecifications
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 39.93kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp781F1053/FLJ12929/ST7 | |
| LRP12 | |
| Yes | |
| wheat germ expression system |
| Liquid | |
| 29967 | |
| LRP12 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKEN | |
| RUO | |
| LRP12 | |
| Wheat Germ (in vitro) | |
| GST |