missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human LRP1 (aa 20-168) Control Fragment Recombinant Protein Product Code.: 30211718
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211718

Invitrogen™ Human LRP1 (aa 20-168) Control Fragment Recombinant Protein

Product Code. 30211718
100 μL, 100µL
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211718

Brand: Invitrogen™ RP102340

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82802 (PA5-82802. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an endocytic receptor involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the A2M-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer patients.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q07954
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4035
Name Human LRP1 (aa 20-168) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A2MR; AI316852; alpha 2-macroglobulin receptor; alpha-2-macroglobulin receptor; APOER; Apolipoprotein E receptor; APR; b2b1554Clo; CD91; FLJ16451; IGFBP3R; LDL receptor related protein 1; lipoprotein receptor-related protein; low density lipoprotein receptor-related protein 1; low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor); Low-density lipoprotein receptor-related protein 1 515 kDa subunit; Low-density lipoprotein receptor-related protein 1 85 kDa subunit; Low-density lipoprotein receptor-related protein 1 intracellular domain; Lrp; Lrp1; LRP-1; LRP1A; LRP-515; LRP-85; LRPICD; MGC88725; Prolow-density lipoprotein receptor-related protein 1; TbetaR-V/LRP-1/IGFBP-3 receptor; TGFBR5; type V tgf-beta receptor
Common Name LRP1 (CD91)
Gene Symbol LRP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less

Certificates

Certificates

A lot number is required to show results for certificates. To find your lot number on previous orders use our order status area.

1 results found
Lot Number Certificate Type Date Product Code
Lot NumberAD4668675C Certificate TypeCertificate of Analysis Date04/04/2025 Product Code
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human LRP1 (aa 20-168) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.