missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30211718

Invitrogen™ Human LRP1 (aa 20-168) Control Fragment Recombinant Protein

Artikelnummer. 30211718
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30211718

Brand: Invitrogen™ RP102340

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82802 (PA5-82802. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an endocytic receptor involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the A2M-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer patients.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q07954
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 4035
Navn Human LRP1 (aa 20-168) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias A2MR; AI316852; alpha 2-macroglobulin receptor; alpha-2-macroglobulin receptor; APOER; Apolipoprotein E receptor; APR; b2b1554Clo; CD91; FLJ16451; IGFBP3R; LDL receptor related protein 1; lipoprotein receptor-related protein; low density lipoprotein receptor-related protein 1; low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor); Low-density lipoprotein receptor-related protein 1 515 kDa subunit; Low-density lipoprotein receptor-related protein 1 85 kDa subunit; Low-density lipoprotein receptor-related protein 1 intracellular domain; Lrp; Lrp1; LRP-1; LRP1A; LRP-515; LRP-85; LRPICD; MGC88725; Prolow-density lipoprotein receptor-related protein 1; TbetaR-V/LRP-1/IGFBP-3 receptor; TGFBR5; type V tgf-beta receptor
Fælles navn LRP1 (CD91)
Gen symbol LRP1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTD
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.