missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LIMK1 Partial ORF (NP_002305, 548 a.a. - 647 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00003984-Q01.10ug

View more versions of this product

Product Code. 16127411

2735.00 DKK / 10µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. [provided by RefSeq]

Sequence: ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD

Specifications

Accession Number	NP_002305
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.74kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Regulatory Status	RUO
Common Name	LIMK1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	3984
Name	LIMK1 (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	LIMK
Gene Symbol	LIMK1
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human LIMK1 Partial ORF (NP_002305, 548 a.a. - 647 a.a.) Recombinant Protein with GST-tag at N-terminal > 10μg

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ Human LIMK1 Partial ORF (NP_002305, 548 a.a. - 647 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers