missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LBX1 Partial ORF (NP_006553.2, 133 a.a. - 219 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010660-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. [provided by RefSeq]
Sequence: TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATASpecifications
| NP_006553.2 | |
| Liquid | |
| 10660 | |
| LBX1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HPX-6/HPX6/LBX1H/homeobox | |
| LBX1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.20kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA | |
| RUO | |
| LBX1 | |
| Wheat Germ (in vitro) | |
| GST |